| Edit |   |
|---|
| Antigenic Specificity | TCTEX1D2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The TCTEX1D2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to TCTEX1D2. This antibody reacts with human. The TCTEX1D2 Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human TCTEX1D2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: PQLTKHLSENIKDKLKEMGFDRYKMVVQVVIGEQRGEGVFMASRCFWDAD |
|---|
| Other Names | MGC33212, Tctex1 domain containing 2, tctex1 domain-containing protein 2 |
|---|
| Gene, Accession # | TCTEX1D2, Gene ID: 255758 |
|---|
| Catalog # | NBP2-13422 |
|---|
| Price | |
|---|
| Order / More Info | TCTEX1D2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|