| Edit |   |
| Antigenic Specificity | TXLNB |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The TXLNB Antibody from Novus Biologicals is a rabbit polyclonal antibody to TXLNB. This antibody reacts with human. The TXLNB Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human TXLNB antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: PPLTPQAEAEGGSDAEPPSKASNSPAGLGAETQCEGLPVGAQADQASWKPEAEASGQAPQAPTEASLQKMEADVPAPACAAEEHVAAM |
| Other Names | taxilin beta |
| Gene, Accession # | TXLNB, Gene ID: 167838, Accession: Q8N3L3, SwissProt: Q8N3L3 |
| Catalog # | NBP2-33926 |
| Price | |
| Order / More Info | TXLNB Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |