| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | TXNDC |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The TXNDC Antibody from Novus Biologicals is a rabbit polyclonal antibody to TXNDC. This antibody reacts with human. The TXNDC Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human TXNDC antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: RRRPQPYPYPSKKLLSESAQPLKKVEEEQEADEEDVSEEEAESKEGTNKDFPQNAIRQRSLGPSLATDKS |
|---|
| Other Names | DKFZp564E1962, PDIA11, protein disulfide isomerase family A, member 11, thioredoxin domain containing 1, thioredoxin domain-containing, Thioredoxin domain-containing protein 1, thioredoxin-related transmembrane protein 1, TMXTXNDC, Transmembrane Trx-related protein, TXNDC1thioredoxin domain containing |
|---|
| Gene, Accession # | TMX1, Gene ID: 81542 |
|---|
| Catalog # | NBP1-87306 |
|---|
| Price | |
|---|
| Order / More Info | TXNDC Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|