| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | MATE1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, rat |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. IHC reported in scientific literature (PMID: 24887156). For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The MATE1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to MATE1. This antibody reacts with human, rat. The MATE1 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human MATE1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: HANLKVNNVPRSGNSALPQDPLHPGCPENLEGILTNDVGKTGEPQSDQQMRQEEPLPEHPQDGAKLSRKQ |
|---|
| Other Names | hMATE-1, MATE-1, MATE1FLJ10847multidrug and toxin extrusion 1, MGC64822, multidrug and toxin extrusion protein 1, Solute carrier family 47 member 1, solute carrier family 47, member 1 |
|---|
| Gene, Accession # | SLC47A1, Gene ID: 55244 |
|---|
| Catalog # | NBP1-87909 |
|---|
| Price | |
|---|
| Order / More Info | MATE1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 24887156 |
|---|
| 产品资料 |
|
|