| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | GPT2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Simple Western, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. In Simple Western only 10 - 15 uL of the recommended dilution is used per data point. Separated by Size. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The GPT2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to GPT2. This antibody reacts with human. The GPT2 Antibody has been validated for the following applications: Western Blot, Simple Western, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human GPT2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: PVSGQAAMDIVVNPPVAGEESFEQFSREKESVLGNLA |
|---|
| Other Names | AAT2, alanine aminotransferase 2, ALT2EC 2.6.1.2, Glutamate pyruvate transaminase 2, glutamic pyruvate transaminase (alanine aminotransferase) 2, Glutamic--alanine transaminase 2, glutamic-pyruvate transaminase 2, Glutamic--pyruvic transaminase 2, GPT 2 |
|---|
| Gene, Accession # | GPT2, Gene ID: 84706 |
|---|
| Catalog # | NBP2-14072 |
|---|
| Price | |
|---|
| Order / More Info | GPT2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|