| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Uridine Phosphorylase 1/UPP1 |
|---|
| Clone | 2F5 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG2a kappa |
|---|
| Format | IgG purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, ELISA, Immunohistochemistry-Paraffin. Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Uridine Phosphorylase 1/UPP1 Antibody (2F5) from Novus Biologicals is a mouse monoclonal antibody to Uridine Phosphorylase 1/UPP1. This antibody reacts with human. The Uridine Phosphorylase 1/UPP1 Antibody (2F5) has been validated for the following applications: Western Blot, ELISA, Immunohistochemistry-Paraffin. |
|---|
| Immunogen | UPP1 (NP_003355, 1 a.a. - 92 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MAATGANAEKAESHNDCPVRLLNPNIAKMKEDILYHFNLTTSRHNFPALFGDVKFVCVGGSPSRMKAFIRCVGAELGLDCPGRDYPNICAGT |
|---|
| Other Names | EC 2.4.2.3, UDRPASE, UPASE, UPP, UPUPase 1, UrdPase 1, uridine phosphorylase, uridine phosphorylase 1 |
|---|
| Gene, Accession # | UPP1, Gene ID: 7378, Accession: NP_003355, SwissProt: NP_003355 |
|---|
| Catalog # | H00007378-M01 |
|---|
| Price | |
|---|
| Order / More Info | Uridine Phosphorylase 1/UPP1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|