| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Uromodulin |
|---|
| Clone | 3F10 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG2b kappa |
|---|
| Format | Protein A purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, ELISA, Immunoprecipitation. This antibody is reactive against recombinant protein in WB and ELISA. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Uromodulin Antibody (3F10) from Novus Biologicals is a mouse monoclonal antibody to Uromodulin. This antibody reacts with human. The Uromodulin Antibody (3F10) has been validated for the following applications: Western Blot, ELISA, Immunoprecipitation. |
|---|
| Immunogen | UMOD (NP_001008390.1, 25 a.a. - 120 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. DTSEARWCSECHSNATCTEDEAVTTCTCQEGFTGDGLTCVDLDECAIPGAHNCSANSSCVNTPGSFSCVCPEGFRLSPGLGCTDVDECAEPGLSHC |
|---|
| Other Names | ADMCKD2, FJHN, HNFJ, HNFJ1, MCKD2, Tamm-Horsfall glycoprotein, Tamm-Horsfall urinary glycoprotein, THGP, THP, uromodulin, uromodulin (uromucoid, Tamm-Horsfall glycoprotein), uromucoid |
|---|
| Gene, Accession # | UMOD, Gene ID: 7369, Accession: NP_001008390, SwissProt: NP_001008390 |
|---|
| Catalog # | H00007369-M03 |
|---|
| Price | |
|---|
| Order / More Info | Uromodulin Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 22516363, 23896093 |
|---|
| 产品资料 |
|
|