| Edit |   |
|---|
| Antigenic Specificity | CAB39 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The CAB39 Antibody from Novus Biologicals is a rabbit polyclonal antibody to CAB39. This antibody reacts with human. The CAB39 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to CAB39(calcium binding protein 39) The peptide sequence was selected from the middle region of CAB39. Peptide sequence KTQPILDILLKNQAKLIEFLSKFQNDRTEDEQFNDEKTYLVKQIRDLKRP. |
|---|
| Other Names | calcium binding protein 39, calcium-binding protein 39, FLJ22682, MO25CGI-66, Protein Mo25 |
|---|
| Gene, Accession # | CAB39, Gene ID: 51719, Accession: Q9Y376, SwissProt: Q9Y376 |
|---|
| Catalog # | NBP1-55393-20ul |
|---|
| Price | |
|---|
| Order / More Info | CAB39 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|