| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | CABC1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The CABC1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to CABC1. This antibody reacts with human. The CABC1 Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human CABC1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: LGDTIMVAKGLVKLTQAAVETHLQHLGIGGELIMAARALQSTAVEQIGMFLGKVQGQDKHEEYFAENFGGPEGEFHFSVPHAAG |
|---|
| Other Names | aarF domain containing kinase 3, chaperone, ABC1 activity of bc1 complex homolog, chaperone, ABC1 activity of bc1 complex homolog (S. pombe), chaperone, ABC1 activity of bc1 complex like (S. pombe), chaperone-ABC1 (activity of bc1 complex, S.pombe)-like, Chaperone-ABC1-like, coenzyme Q8 homolog, EC 2.7.11, EC 2.7.11.-, MGC4849, mitochondrial, SCAR9 |
|---|
| Gene, Accession # | ADCK3, Gene ID: 56997 |
|---|
| Catalog # | NBP2-56006 |
|---|
| Price | |
|---|
| Order / More Info | CABC1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|