| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Mind Bomb 2/MIB2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Mind Bomb 2/MIB2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Mind Bomb 2/MIB2. This antibody reacts with human. The Mind Bomb 2/MIB2 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human Mind Bomb 2/MIB2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: PNIICDCCKKHGLRGMRWKCRVCLDYDLCTQCYMHNKHELAHAFDRYETAHSRPVTLSPRQGLPRIPLRGIFQ |
|---|
| Other Names | E3 ubiquitin-protein ligase MIB2, EC 6.3.2, EC 6.3.2.-, EC 6.3.2.13, FLJ20648, FLJ41406, Mind bomb homolog 2, mindbomb homolog 2 (Drosophila), Novel zinc finger protein, novelzin, Putative NF-kappa-B-activating protein 002N, SKD, Skeletrophin, Zinc finger ZZ type with ankyrin repeat domain protein 1, ZZ type with ankyrin repeat domain 1, ZZANK1 |
|---|
| Gene, Accession # | MIB2, Gene ID: 142678 |
|---|
| Catalog # | NBP2-57751 |
|---|
| Price | |
|---|
| Order / More Info | Mind Bomb 2/MIB2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|