| Edit |   |
| Antigenic Specificity | CABP4 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The CABP4 Antibody from Novus Biologicals is a rabbit polyclonal antibody to CABP4. This antibody reacts with human. The CABP4 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to CABP4 (calcium binding protein 4) The peptide sequence was selected from the N terminal of CABP4. Peptide sequence PSTGEGPAGAPPASPGPASSRQSHRHRPDSLHDAAQRTYGPLLNRVFGKD. |
| Other Names | CaBP4, calcium binding protein 4, CSNB2Bcalcium-binding protein 4 |
| Gene, Accession # | CABP4, Gene ID: 57010, Accession: P57796, SwissProt: P57796 |
| Catalog # | NBP1-68995 |
| Price | |
| Order / More Info | CABP4 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |