| 产品详情 |
| Edit |   |
| Antigenic Specificity | CABYR |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. For Immunofluorescence, Fixation/Permeabilization: PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The CABYR Antibody from Novus Biologicals is a rabbit polyclonal antibody to CABYR. This antibody reacts with human. The CABYR Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human CABYR antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: GKVSSIHSDQSDVLMVDVATSMPVVIKEVPSSEAAEDVMVAAPLVCSGKV LEVQVVNQTSVHVDLGSQPKENEAEPSTASSVPLQDEQEPPAY |
| Other Names | CABYRa, CABYRc, calcium binding tyrosine-(Y)-phosphorylation regulated, Calcium-binding protein 86, calcium-binding tyrosine-(Y)-phosphorylation regulated (fibrousheathin 2), Cancer/testis antigen 88, CBP86CABYRc/d, CT88MGC9117, fibrousheathin 2, Fibrousheathin II, fibrousheathin-2, FSP-2calcium binding tyrosine-(Y)-phosphorylation regulated (fibrousheathin 2), FSP2calcium-binding tyrosine phosphorylation-regulated protein, Testis-specific calcium-binding protein CBP86 |
| Gene, Accession # | CABYR, Gene ID: 26256 |
| Catalog # | NBP2-14429 |
| Price | |
| Order / More Info | CABYR Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|