| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | CACNA1A |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The CACNA1A Antibody from Novus Biologicals is a rabbit polyclonal antibody to CACNA1A. This antibody reacts with human. The CACNA1A Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human CACNA1A antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: KFHTTCFEEGTDDIQGESPAPCGTEEPARTCPNGTKCQPYWEGPNNGI |
|---|
| Other Names | APCA, BI, brain calcium channel 1, Brain calcium channel I, CACH4, CACN3, CACNL1A4CAV2.1, calcium channel, L type, alpha-1 polypeptide, Calcium channel, L type, alpha-1 polypeptide isoform 4, calcium channel, voltage-dependent, P/Q type, alpha 1A subunit, Cav2.1, EA2, FHM, HPCA, MHP, MHP1, SCA6, voltage-dependent P/Q-type calcium channel subunit alpha-1A, Voltage-gated calcium channel subunit alpha Cav2.1 |
|---|
| Gene, Accession # | CACNA1A, Gene ID: 773, Accession: O00555, SwissProt: O00555 |
|---|
| Catalog # | NBP2-38049 |
|---|
| Price | |
|---|
| Order / More Info | CACNA1A Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|