| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | CACNA2D2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The CACNA2D2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to CACNA2D2. This antibody reacts with human. The CACNA2D2 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human CACNA2D2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: EAWAEKFKVLASNRTHQDQPQKCGPNSHCEMDCEVNNEDLLCVLIDDGGFLVLSNQNHQWDQVGRFFSEVDANLMLALYN |
|---|
| Other Names | alpha 2 delta calcium channel subunit, CACNA2D, calcium channel, voltage-dependent, alpha 2/delta subunit 2, gene 26, KIAA0558Voltage-gated calcium channel subunit alpha-2/delta-2, LUAC11.1, voltage-dependent calcium channel subunit alpha-2/delta-2 |
|---|
| Gene, Accession # | CACNA2D2, Gene ID: 9254 |
|---|
| Catalog # | NBP1-81501 |
|---|
| Price | |
|---|
| Order / More Info | CACNA2D2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|