| Edit |   |
|---|
| Antigenic Specificity | Spastic Paraplegia 20 (Troyer Syndrome) (SPG20) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | This gene encodes a protein containing a MIT (Microtubule Interacting and Trafficking molecule) domain, and is implicated in regulating endosomal trafficking and mitochondria function. The protein localizes to mitochondria and partially co-localizes with microtubules. Stimulation with epidermal growth factor (EGF) results in protein translocation to the plasma membrane, and the protein functions in the degradation and intracellular trafficking of EGF receptor. Multiple alternatively spliced variants, encoding the same protein, have been identified. |
|---|
| Immunogen | SPG20 antibody was raised using a synthetic peptide corresponding to a region with amino acids ASWVSWGLVKGAEITGKAIQKGASKLRERIQPEEKPVEVSPAVTKGLYIA |
|---|
| Other Names | SPARTIN|TAHCCP1|spartin|AI840044|C79168|mKIAA0610 |
|---|
| Gene, Accession # | Gene ID: 23111 |
|---|
| Catalog # | ABIN631734 |
|---|
| Price | |
|---|
| Order / More Info | Spastic Paraplegia 20 (Troyer Syndrome) (SPG20) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|