| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Smad5 |
|---|
| Clone | 1C1 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG2a kappa |
|---|
| Format | IgG purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, ELISA. Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for ELISA. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Smad5 Antibody (1C1) from Novus Biologicals is a mouse monoclonal antibody to Smad5. This antibody reacts with human. The Smad5 Antibody (1C1) has been validated for the following applications: Western Blot, ELISA. |
|---|
| Immunogen | SMAD5 (NP_005894 173 a.a. - 268 a.a.) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. FPDSFHQPNNTPFPLSPNSPYPPSPASSTYPNSPASSGPGSPFQLPADTPPPAYMPPDDQMGQDNSQPMDTSNNMIPQIMPSISSRDVQPVAYEEP |
|---|
| Other Names | hSmad5, JV5-1DKFZp781O1323, MAD homolog 5, MAD, mothers against decapentaplegic homolog 5 (Drosophila), MADH5mothers against decapentaplegic homolog 5, mothers against decapentaplegic homolog 5, mothers against decapentaplegic, drosophila, homolog of, 5, Mothers against DPP homolog 5, SMA- and MAD-related protein 5, SMAD 5, SMAD family member 5DKFZp781C1895, SMAD, mothers against DPP homolog 5, SMAD, mothers against DPP homolog 5 (Drosophila), Smad5 |
|---|
| Gene, Accession # | SMAD5, Gene ID: 4090, Accession: NP_005894, SwissProt: NP_005894 |
|---|
| Catalog # | H00004090-M11 |
|---|
| Price | |
|---|
| Order / More Info | Smad5 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|