Edit |   |
Antigenic Specificity | VMP1 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human (antigen sequence identity: mouse 84%, rat 88%) |
Isotype | n/a |
Format | antigen affinity purified |
Size | 100 µl |
Concentration | n/a |
Applications | ICC-IF |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-human VMP1 polyclonal antibody. |
Immunogen | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: MAENGKNCDQRRVAMNKEHHNGNFTDPSSVNEKKRREREERQNIVLWRQP |
Other Names | vacuole membrane protein 1, EPG3, TANGO5, TMEM49 |
Gene, Accession # | Gene ID: 81671, UniProt: Q96GC9, ENSG00000062716 |
Catalog # | HPA064780 |
Price | |
Order / More Info | VMP1 Antibody from ATLAS ANTIBODIES AB |
Product Specific References | n/a |