| Edit |   |
|---|
| Antigenic Specificity | LGICZ1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 0.05 mg |
|---|
| Concentration | 1 mg/ml |
|---|
| Applications | Western Blot (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | LGICZ1 antibody. Specificity: LGICZ1 antibody was raised against the N terminal Of Lgicz1 |
|---|
| Immunogen | LGICZ1 antibody was raised using the N terminal Of Lgicz1 corresponding to a region with amino acids PSLFNVNLSKKVQESIQIPNNGSAPLLVDVRVFVSNVFNVDILRYTMSSM |
|---|
| Other Names | LGICZ1; LGICZ1; LGICZ 1; LGICZ-1; LGICZ; L2; LGICZ1; ZAC; MGC129841, |
|---|
| Gene, Accession # | LGICZ1 |
|---|
| Catalog # | MBS5302051 |
|---|
| Price | |
|---|
| Order / More Info | LGICZ1 Antibody from MYBIOSOURCE INC. |
|---|
| Product Specific References | n/a |
|---|