| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | SHC3 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The SHC3 Antibody from Novus Biologicals is a rabbit polyclonal antibody to SHC3. This antibody reacts with human. The SHC3 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to SHC3(SHC (Src homology 2 domain containing) transforming protein 3) The peptide sequence was selected from the middle region of SHC3. Peptide sequence RLKPRPHAPDTAQFAGKEQTYYQGRHLGDTFGEDWQQTPLRQGSSDIYST. |
|---|
| Other Names | Neuronal Shc, NSHCDKFZp686H1544, N-Shcsrc homology 2 domain containing transforming protein C3, Protein Rai, RAI, SH2 domain protein C3, SHC (Src homology 2 domain containing) transforming protein 3, SHCCFLJ45325, SHC-transforming protein 3, SHC-transforming protein C, src homology 2 domain-containing transforming protein C3, Src homology 2 domain-containing-transforming protein C3 |
|---|
| Gene, Accession # | SHC3, Gene ID: 53358, Accession: Q92529, SwissProt: Q92529 |
|---|
| Catalog # | NBP1-54810 |
|---|
| Price | |
|---|
| Order / More Info | SHC3 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|