| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | SHCBP1L |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The SHCBP1L Antibody from Novus Biologicals is a rabbit polyclonal antibody to SHCBP1L. This antibody reacts with human. The SHCBP1L Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human SHCBP1L antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: FPGEYQAANLALLTDDIIIKGVGKREEIMITSEPSRDSFVVSKADNVKLMHLSLIQQGTVDGIVVVESGHMTLENCILKCEGTGVC |
|---|
| Other Names | C1orf14, GE36, MGC26911, SHC SH2 domain-binding protein 1-like protein, SHC SH2-domain binding protein 1-like |
|---|
| Gene, Accession # | SHCBP1L, Gene ID: 81626 |
|---|
| Catalog # | NBP1-90716 |
|---|
| Price | |
|---|
| Order / More Info | SHCBP1L Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|