| Edit |   |
|---|
| Antigenic Specificity | TMEM63A |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified, no preservative |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The TMEM63A Antibody from Novus Biologicals is a rabbit polyclonal antibody to TMEM63A. This antibody reacts with human. The TMEM63A Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to TMEM63A(transmembrane protein 63A) The peptide sequence was selected from the N terminal of TMEM63A. Peptide sequence MDSPFLELWQSKAVSIREQLGLGDRPNDSYCYNSAKNSTVLQGVTFGGIP. |
|---|
| Other Names | KIAA0792KIAA0489, transmembrane protein 63A |
|---|
| Gene, Accession # | TMEM63A, Gene ID: 9725, Accession: O94886, SwissProt: O94886 |
|---|
| Catalog # | NBP1-69249 |
|---|
| Price | |
|---|
| Order / More Info | TMEM63A Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|