| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | TMEM90A |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The TMEM90A Antibody from Novus Biologicals is a rabbit polyclonal antibody to TMEM90A. This antibody reacts with human. The TMEM90A Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human TMEM90A antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: ESLSELQNPLLPRSPAHLHGPYPYPETPPSWSCQEKLYSYLLGGAGPAGAHQLLDPGSLQLAVEAWYRPSCLLGRDKVKE |
|---|
| Other Names | CAPUCIN, Caudate- And Putamen-Enriched Sequence, Caudate-And Putamen-Enriched Sequence, Dispanin Subfamily C Member 1, DSPC1, IFITMD4, Interferon Induced Transmembrane Protein Domain Containing 4, Synapse Differentiation Inducing 1-Like, Synapse Differentiation-Inducing Gene Protein 1-Like, SYNDIG1L, Transmembrane Protein 90A |
|---|
| Gene, Accession # | SYNDIG1L, Gene ID: 646658, Accession: A6NDD5, SwissProt: A6NDD5 |
|---|
| Catalog # | NBP2-30430 |
|---|
| Price | |
|---|
| Order / More Info | TMEM90A Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|