| Edit |   |
| Antigenic Specificity | TMEM132B |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 20ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The TMEM132B Antibody from Novus Biologicals is a rabbit polyclonal antibody to TMEM132B. This antibody reacts with human. The TMEM132B Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptide directed towards the middle region of human TMEM132B. Peptide sequence VQEWFHRGTPVGQEESTNKSTTPQSPMEGKNKLLKSGGPDAFTSFPTQGK. |
| Other Names | KIAA1786, transmembrane protein 132B |
| Gene, Accession # | TMEM132B, Gene ID: 114795, Accession: NP_443139, SwissProt: NP_443139 |
| Catalog # | NBP1-91364-20ul |
| Price | |
| Order / More Info | TMEM132B Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |