Edit |   |
Antigenic Specificity | Aldo-keto Reductase Family 1, Member C2 (AKR1C2) |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | affinity purified |
Size | 50 µg |
Concentration | n/a |
Applications | Western Blotting (WB) |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | This gene encodes a member of the aldo/keto reductase superfamily, which consists of more than 40 known enzymes and proteins. These enzymes catalyze the conversion of aldehydes and ketones to their corresponding alcohols using NADH and/or NADPH as cofactors. The enzymes display overlapping but distinct substrate specificity. This enzyme binds bile acid with high affinity, and shows minimal 3-alpha-hydroxysteroid dehydrogenase activity. This gene shares high sequence identity with three other gene members and is clustered with those three genes at chromosome 10p15-p14. |
Immunogen | AKR1 C2 antibody was raised using a synthetic peptide corresponding to a region with amino acids LEAVKLAIEAGFHHIDSAHVYNNEEQVGLAIRSKIADGSVKREDIFYTSK |
Other Names | AKR1C-pseudo|BABP|DD|DD2|DDH2|HAKRD|HBAB|MCDR2|SRXY8|Akr1c21 |
Gene, Accession # | Gene ID: 1646 |
Catalog # | ABIN632618 |
Price | |
Order / More Info | Aldo-keto Reductase Family 1, Member C2 (AKR1C2) Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |