| 产品详情 |
| Edit |   |
| Antigenic Specificity | DNA polymerase sigma |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, mouse |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The DNA polymerase sigma Antibody from Novus Biologicals is a rabbit polyclonal antibody to DNA polymerase sigma. This antibody reacts with human, mouse. The DNA polymerase sigma Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human, mouse DNA polymerase sigma antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: ARSYPNRDAESTLGRIIKVTQEVIDYRRWIKEKWGSKAHPSPGMDSRIKI KERIATCNGEQTQNREPESPYGQRLTLSLSS |
| Other Names | DNA polymerase kappa, DNA polymerase sigma, EC 2.7.7.7, LAK-1TUTase 5, PAP associated domain containing 7, POLKTRF41, POLSTUTASE5, polymerase (DNA directed) sigma, polymerase (DNA-directed) sigma, Terminal uridylyltransferase 5, Topoisomerase-related function protein 4-1, TRF4-1LAK1, TRF4PAP-associated domain-containing protein 7 |
| Gene, Accession # | PAPD7, Gene ID: 11044 |
| Catalog # | NBP2-13729 |
| Price | |
| Order / More Info | DNA polymerase sigma Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|