| 产品详情 |
| Edit |   |
| Antigenic Specificity | NM23-H1 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, mouse, rat |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. IHC reported in scientific literature (PMID: 21738817). For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The NM23-H1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to NM23-H1. This antibody reacts with human, mouse, rat. The NM23-H1 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human, mouse, rat NME1-NME2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: MVLLSTLGIVFQGEGPPISSCDTGTMANCERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVGLKFMQ |
| Other Names | EC 2.7.4.6, GAAD, Granzyme A-activated DNase, Metastasis inhibition factor nm23, NB, NBS, NDK A, NDKA, NDP kinase A, NDPKA, NDPK-A, NM23AWD, nm23-H1, non-metastatic cells 1, protein (NM23A) expressed in, nucleoside diphosphate kinase A, Tumor metastatic process-associated protein |
| Gene, Accession # | NME1, Gene ID: 4830, Accession: P15531, P15531, P15531, P15531 |
| Catalog # | NBP1-80992 |
| Price | |
| Order / More Info | NM23-H1 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | PubMed: 19287070, 21738817 |
| 产品资料 |
|
|