| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | DNTTIP2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The DNTTIP2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to DNTTIP2. This antibody reacts with human. The DNTTIP2 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human DNTTIP2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: DEGKEINEKSSQLKNLSELQDTSLQQLVSQRHSTPQNKNAVSVHSNLNSEAVMKSLTQTFATVEVGRWNNNKKSPIKASDLTKFGDCGGSDD |
|---|
| Other Names | acidic 82 kDa protein mRNA, deoxynucleotidyltransferase terminal-interacting protein 2, deoxynucleotidyltransferase, terminal, interacting protein 2, ERBP, estrogen receptor binding protein, FCF2, FLJ98849, HSU15552, LPTS-interacting protein 2, LPTS-RP2, MGC163494, TdIF2, tdT-interacting factor 2 |
|---|
| Gene, Accession # | DNTTIP2, Gene ID: 30836, Accession: Q5QJE6, SwissProt: Q5QJE6 |
|---|
| Catalog # | NBP2-38710 |
|---|
| Price | |
|---|
| Order / More Info | DNTTIP2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|