| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Matriptase/ST14 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Matriptase/ST14 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Matriptase/ST14. This antibody reacts with human. The Matriptase/ST14 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. |
|---|
| Immunogen | Synthetic peptides corresponding to ST14(suppression of tumorigenicity 14 (colon carcinoma)) The peptide sequence was selected from the C terminal of ST14 (AAH18146). Peptide sequence SHVFPAGKAIWVTGWGHTQYGGTGALILQKGEIRVINQTTCENLLPQQIT. |
|---|
| Other Names | EC 3.4.21, HAI, Matriptase, Membrane-type serine protease 1, MT-SP1EC 3.4.21.109, prostamin, PRSS14, Serine protease 14, Serine protease TADG-15, SNC19MTSP1, suppression of tumorigenicity 14 (colon carcinoma), suppression of tumorigenicity 14 (colon carcinoma, matriptase, epithin), suppressor of tumorigenicity 14 protein, TADG15, TMPRSS14, tumor associated differentially expressed gene 15 protein, Tumor-associated differentially-expressed gene 15 protein |
|---|
| Gene, Accession # | ST14, Gene ID: 6768, Accession: Q8WVC1, SwissProt: Q8WVC1 |
|---|
| Catalog # | NBP1-56649 |
|---|
| Price | |
|---|
| Order / More Info | Matriptase/ST14 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|