| Edit |   |
| Antigenic Specificity | Uroplakin II |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 25ul |
| Concentration | n/a |
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The Uroplakin II Antibody from Novus Biologicals is a rabbit polyclonal antibody to Uroplakin II. This antibody reacts with human. The Uroplakin II Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: ISSLSGLLSPALTESLLVALPPCHLTGGNATLMVRRANDSKVVTSSFVVPPCRGRRELVS |
| Other Names | UP2, UPII, UPK2 uroplakin 2 |
| Gene, Accession # | UPK2, Gene ID: 7379, Accession: O00526, SwissProt: O00526 |
| Catalog # | NBP2-33389-25ul |
| Price | |
| Order / More Info | Uroplakin II Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |