| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | SRGN |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified, no preservative |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The SRGN Antibody from Novus Biologicals is a rabbit polyclonal antibody to SRGN. This antibody reacts with human. The SRGN Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptide directed towards the middle region of human SRGN. Peptide sequence RTDLFPKTRIQDLNRIFPLSEDYSGSGFGSGSGSGSGSGSGFLTEMEQDY. |
|---|
| Other Names | FLJ12930, Hematopoetic proteoglycan core protein, MGC9289, P.PG, Platelet proteoglycan core protein, platelet proteoglycan protein core, PPG, PRG1p.PG, PRGhematopoetic proteoglycan core peptide, proteoglycan 1, secretory granule, proteoglycan protein core for mast cell secretory granule, secretory granule proteoglycan 1, secretory granule proteoglycan core peptide, Secretory granule proteoglycan core protein, serglycin, serglycin proteoglycan |
|---|
| Gene, Accession # | SRGN, Gene ID: 5552, Accession: NP_002718, SwissProt: NP_002718 |
|---|
| Catalog # | NBP1-80447 |
|---|
| Price | |
|---|
| Order / More Info | SRGN Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|