| Edit |   |
|---|
| Antigenic Specificity | SRP19 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified, no preservative |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The SRP19 Antibody from Novus Biologicals is a rabbit polyclonal antibody to SRP19. This antibody reacts with human. The SRP19 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry. |
|---|
| Immunogen | Synthetic peptides corresponding to SRP19(signal recognition particle 19kDa) The peptide sequence was selected from the middle region of SRP19. Peptide sequence CLVQFPSRKSVMLYAAEMIPKLKTRTQKTGGADQSLQQGEGSKKGKGKKK. |
|---|
| Other Names | signal recognition particle 19 kDa protein, signal recognition particle 19kD, signal recognition particle 19kDa |
|---|
| Gene, Accession # | SRP19, Gene ID: 6728 |
|---|
| Catalog # | NBP1-57415-20ul |
|---|
| Price | |
|---|
| Order / More Info | SRP19 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|