| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | SRp55 |
|---|
| Clone | 6A10 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG3 kappa |
|---|
| Format | IgG purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, ELISA. Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The SRp55 Antibody (6A10) from Novus Biologicals is a mouse monoclonal antibody to SRp55. This antibody reacts with human. The SRp55 Antibody (6A10) has been validated for the following applications: Western Blot, ELISA. |
|---|
| Immunogen | SFRS6 (NP_006266, 1 a.a. - 75 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MPRVYIGRLSYNVREKDIQRFFSGYGRLLEVDLKNGYGFVEFEDSRDADDAVYELNGKELCGERVIVEHARGPRR |
|---|
| Other Names | B52, FLJ08061, pre-mRNA splicing factor SRP55, Pre-mRNA-splicing factor SRP55, serine/arginine-rich splicing factor 6, SFRS6, Splicing factor, arginine/serine-rich 6MGC5045, splicing factor, arginine/serine-rich, 55 kDa, SR splicing factor 6, SRP55arginine/serine-rich splicing factor 6 |
|---|
| Gene, Accession # | SRSF6, Gene ID: 6431, Accession: NP_006266, SwissProt: NP_006266 |
|---|
| Catalog # | H00006431-M01 |
|---|
| Price | |
|---|
| Order / More Info | SRp55 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|