| Edit |   |
| Antigenic Specificity | SRP68 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified, no preservative |
| Size | 20ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The SRP68 Antibody from Novus Biologicals is a rabbit polyclonal antibody to SRP68. This antibody reacts with human. The SRP68 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to SRP68(signal recognition particle 68kDa) The peptide sequence was selected from the N terminal of SRP68. Peptide sequence EENKENERPSAGSKANKEFGDSLSLEILQIIKESQQQHGLRHGDFQRYRG. |
| Other Names | signal recognition particle 68 kDa protein, signal recognition particle 68kD, signal recognition particle 68kDa |
| Gene, Accession # | SRP68, Gene ID: 6730, Accession: Q9UHB9, SwissProt: Q9UHB9 |
| Catalog # | NBP1-57137-20ul |
| Price | |
| Order / More Info | SRP68 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |