| Edit |   |
|---|
| Antigenic Specificity | CCDC76 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 0.05 mg |
|---|
| Concentration | 1 mg/ml |
|---|
| Applications | Western Blot (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | CCDC76 antibody. Specificity: CCDC76 antibody was raised against the N terminal of CCDC76 |
|---|
| Immunogen | CCDC76 antibody was raised using the N terminal of CCDC76 corresponding to a region with amino acids QLAKHLKKCNSREKPKPDFYIQDINAGLRDETEIPEQLVPISSLSEEQLE |
|---|
| Other Names | coiled-coil domain containing 76, isoform CRA_d; tRNA:m(4)X modification enzyme TRM13 homolog; tRNA:m(4)X modification enzyme TRM13 homolog; tRNA methyltransferase 13 homolog (S. cerevisiae); Coiled-coil domain-containing protein 76, TRMT13; TRMT13; CCDC76; CCDC76 |
|---|
| Gene, Accession # | CCDC76, Gene ID: 54482, NCBI: EAW72973.1 |
|---|
| Catalog # | MBS5300811 |
|---|
| Price | |
|---|
| Order / More Info | CCDC76 Antibody from MYBIOSOURCE INC. |
|---|
| Product Specific References | n/a |
|---|