| Edit |   |
|---|
| Antigenic Specificity | CCDC78 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 0.05 mg |
|---|
| Concentration | 1 mg/ml |
|---|
| Applications | Western Blot (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | CCDC78 antibody. Specificity: CCDC78 antibody was raised against the middle region of CCDC78 |
|---|
| Immunogen | CCDC78 antibody was raised using the middle region of CCDC78 corresponding to a region with amino acids QELRHKAQVPGHSDDHRFQVQPKNTMDPENEQHRLGSGVSVQPPSSGERA |
|---|
| Other Names | coiled-coil domain-containing protein 78; Coiled-coil domain-containing protein 78; coiled-coil domain-containing protein 78; coiled-coil domain containing 78; hsCCDC78, CCDC78; CCDC78; CNM4; JFP10; C16orf25; hsCCDC78; C16orf25 |
|---|
| Gene, Accession # | CCDC78, Gene ID: 124093, NCBI: NP_001026907.2 |
|---|
| Catalog # | MBS5301796 |
|---|
| Price | |
|---|
| Order / More Info | CCDC78 Antibody from MYBIOSOURCE INC. |
|---|
| Product Specific References | n/a |
|---|