| Edit |   |
|---|
| Antigenic Specificity | CCDC87 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 0.05 mg |
|---|
| Concentration | 1 mg/ml |
|---|
| Applications | Western Blot (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | CCDC87 antibody. Specificity: CCDC87 antibody was raised against the N terminal of CCDC87 |
|---|
| Immunogen | CCDC87 antibody was raised using the N terminal of CCDC87 corresponding to a region with amino acids MMEPPKPEPELQRFYHRLLRPLSLFPTRTTSPEPQKRPPQEGRILQSFPL |
|---|
| Other Names | Ccdc87 protein; Coiled-coil domain-containing protein 87; coiled-coil domain-containing protein 87; coiled-coil domain containing 87, Ccdc87; Ccdc87; 4931419P11Rik |
|---|
| Gene, Accession # | CCDC87, Gene ID: 399599, NCBI: AAI45661.1 |
|---|
| Catalog # | MBS5300423 |
|---|
| Price | |
|---|
| Order / More Info | CCDC87 Antibody from MYBIOSOURCE INC. |
|---|
| Product Specific References | n/a |
|---|