| Edit |   |
|---|
| Antigenic Specificity | CYP27C1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 0.05 mg |
|---|
| Concentration | 1 mg/ml |
|---|
| Applications | Western Blot (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | CYP27C1 antibody. Specificity: CYP27C1 antibody was raised against the middle region of CYP27C1 |
|---|
| Immunogen | CYP27C1 antibody was raised using the middle region of CYP27C1 corresponding to a region with amino acids VTQEDLVIGGYLIPKGTQLALCHYATSYQDENFPRAKEFRPERWLRKGDL |
|---|
| Other Names | CYP27C1; CYP27C1; FLJ16008; CYPC1 27; CYP27C1; Cytochrome P450 Family 27 Subfamily C Polypeptide 1; CYPC1-27, |
|---|
| Gene, Accession # | CYP27C1 |
|---|
| Catalog # | MBS5301597 |
|---|
| Price | |
|---|
| Order / More Info | CYP27C1 Antibody from MYBIOSOURCE INC. |
|---|
| Product Specific References | n/a |
|---|