| Edit |   |
|---|
| Antigenic Specificity | RIPPLY2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The RIPPLY2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to RIPPLY2. This antibody reacts with human. The RIPPLY2 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human RIPPLY2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: MENAGGAEGTESGAAACAATDGPTRRAGADSGYAGFWRPWVDAGGKKEEETPNHAAEAMPDGPGMTAASGKLYQFRHPV |
|---|
| Other Names | C6orf159, C6orf59, Chromosome 6 Open Reading Frame 159, Ripply Transcriptional Repressor 2, Ripply2 Homolog, Ripply2 Homolog (Zebrafish) |
|---|
| Gene, Accession # | RIPPLY2, Gene ID: 134701, Accession: Q5TAB7, SwissProt: Q5TAB7 |
|---|
| Catalog # | NBP2-33489 |
|---|
| Price | |
|---|
| Order / More Info | RIPPLY2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|