| Edit |   |
|---|
| Antigenic Specificity | Clusterin-like 1/CLUL1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Clusterin-like 1/CLUL1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Clusterin-like 1/CLUL1. This antibody reacts with human. The Clusterin-like 1/CLUL1 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to CLUL1 (clusterin-like 1 (retinal)) The peptide sequence was selected from the middle region of CLUL1)(50ug). Peptide sequence TEIIFNSIQVVPRIHEGNISKQDETMMTDLSILPSSNFTLKIPLEESAES. |
|---|
| Other Names | clusterin-like 1 (retinal), clusterin-like protein 1, RA337M, Retinal-specific clusterin-like protein |
|---|
| Gene, Accession # | CLUL1, Gene ID: 27098, Accession: Q15846, SwissProt: Q15846 |
|---|
| Catalog # | NBP1-57712 |
|---|
| Price | |
|---|
| Order / More Info | Clusterin-like 1/CLUL1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|