| Edit |   |
|---|
| Antigenic Specificity | TRA16 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The TRA16 Antibody from Novus Biologicals is a rabbit polyclonal antibody to TRA16. This antibody reacts with human. The TRA16 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to TRA16 The peptide sequence was selected from the N terminal of TRA16. Peptide sequence THSLVCPETVSRVSSVLNRNTRQFGKKHLFDQDEETCWNSDQGPSQWVTL. |
|---|
| Other Names | nuclear receptor 2C2-associated protein, repressor for TR4 transactivation, TR4 orphan receptor associated protein TRA16, TRA16TR4 orphan receptor-associated 16 kDa protein |
|---|
| Gene, Accession # | NR2C2AP, Gene ID: 126382, Accession: Q86WQ0, SwissProt: Q86WQ0 |
|---|
| Catalog # | NBP1-56746 |
|---|
| Price | |
|---|
| Order / More Info | TRA16 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|