| Edit |   |
| Antigenic Specificity | NXPH4 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 20ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The NXPH4 Antibody from Novus Biologicals is a rabbit polyclonal antibody to NXPH4. This antibody reacts with human. The NXPH4 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to NXPH4 (neurexophilin 4) The peptide sequence was selected from the N terminal of NXPH4)(50ug). Peptide sequence MRLLPEWFLLLFGPWLLRKAVSAQIPESGRPQYLGLRPAAAGAGAPGQQL. |
| Other Names | neurexophilin 4, NPH4neurexophilin-4 |
| Gene, Accession # | NXPH4, Gene ID: 11247 |
| Catalog # | NBP1-57773-20ul |
| Price | |
| Order / More Info | NXPH4 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |