| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | OAS1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The OAS1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to OAS1. This antibody reacts with human. The OAS1 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. |
|---|
| Immunogen | Synthetic peptides corresponding to OAS1(2',5'-oligoadenylate synthetase 1, 40/46kDa) The peptide sequence was selected from the C terminal of OAS1. Peptide sequence GWRQLAQEAEAWLNYPCFKNWDGSPVSSWILLVRPPASSLPFIPAPLHEA. |
|---|
| Other Names | (2-5')oligo(A) synthase 1,2'-5'-oligoadenylate synthetase 1,2-5A synthase 1,2'-5'-oligoisoadenylate synthetase 1, (2-5')oligo(A) synthetase 1, 2'-5'-oligo A synthetase 1, 2'-5'-oligoadenylate synthase 1, 2'-5'-oligoadenylate synthetase 1 (40-46 kD), 2'-5'-oligoadenylate synthetase 1, 40/46kDa, E18/E16,2-5A synthetase 1, EC 2.7.7, EC 2.7.7.-, IFI-4,2'-5' oligoadenylate synthetase 1 p52 isoform, OIAS2'-5' oligoadenylate synthetase 1 p48 isoform, OIASI, p46/p42 OAS |
|---|
| Gene, Accession # | OAS1, Gene ID: 4938, Accession: P00973-2, SwissProt: P00973-2 |
|---|
| Catalog # | NBP1-58950 |
|---|
| Price | |
|---|
| Order / More Info | OAS1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|