| Edit |   |
|---|
| Antigenic Specificity | Hydroxyacid Oxidase-1/HAO-1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified, no preservative |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Hydroxyacid Oxidase-1/HAO-1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Hydroxyacid Oxidase-1/HAO-1. This antibody reacts with human. The Hydroxyacid Oxidase-1/HAO-1 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to HAO1(hydroxyacid oxidase (glycolate oxidase) 1) The peptide sequence was selected from the C terminal of HAO1. Peptide sequence GLNGILVSNHGARQLDGVPATIDVLPEIVEAVEGKVEVFLDGGVRKGTDV. |
|---|
| Other Names | (S)-2-hydroxy-acid oxidase, EC 1.1.3.15, Glycolate oxidase, GOX1MGC142227, GOXMGC142225, HAOX1, hydroxyacid oxidase (glycolate oxidase) 1, hydroxyacid oxidase 1 |
|---|
| Gene, Accession # | HAO1, Gene ID: 54363, Accession: Q9UJM8, SwissProt: Q9UJM8 |
|---|
| Catalog # | NBP1-55294 |
|---|
| Price | |
|---|
| Order / More Info | Hydroxyacid Oxidase-1/HAO-1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|