| Edit |   |
|---|
| Antigenic Specificity | RPS10 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The RPS10 Antibody from Novus Biologicals is a rabbit polyclonal antibody to RPS10. This antibody reacts with human. The RPS10 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | The immunogen for this antibody is RPS10 - C-terminal region. Peptide sequence PKGLEGERPARLTRGEADRDTYRRSAVPPGADKKAEAGAGSATEFQFRGG. |
|---|
| Other Names | DBA9,40S ribosomal protein S10, MGC88819, ribosomal protein S10 |
|---|
| Gene, Accession # | RPS10, Gene ID: 6204, Accession: NP_001005, SwissProt: NP_001005 |
|---|
| Catalog # | NBP1-98599 |
|---|
| Price | |
|---|
| Order / More Info | RPS10 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|