| Edit |   |
| Antigenic Specificity | RPS17 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 20ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The RPS17 Antibody from Novus Biologicals is a rabbit polyclonal antibody to RPS17. This antibody reacts with human. The RPS17 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | The immunogen for this antibody is RPS17 - C-terminal region. Peptide sequence SIKLQEEERERRDNYVPEVSALDQEIIEVDPDTKEMLKLLDFGSLSNLQV. |
| Other Names | 40S ribosomal protein S17, DBA4, ribosomal protein S17, RPS17L1RPS17L2MGC72007 |
| Gene, Accession # | RPS17, Gene ID: 6218, Accession: NP_001012, SwissProt: NP_001012 |
| Catalog # | NBP1-98593-20ul |
| Price | |
| Order / More Info | RPS17 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |