| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | CXCR3 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The CXCR3 Antibody from Novus Biologicals is a rabbit polyclonal antibody to CXCR3. This antibody reacts with human. The CXCR3 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human CXCR3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: QVSDHQVLNDAEVAALLENFSSSYDYGENESDSCCTSPPCPQDFSLNFDRAF |
|---|
| Other Names | CD183, CD183 antigen, chemokine (C-X-C motif) receptor 3, chemokine (C-X-C) receptor 3, CKR-L2IP-10 receptor, CMKAR3, C-X-C chemokine receptor type 3, CXC-R3, CXCR-3, G protein-coupled receptor 9CD182, GPR9Mig-R, Interferon-inducible protein 10 receptor, IP10 receptor, IP10-R, Mig receptor, MigR |
|---|
| Gene, Accession # | CXCR3, Gene ID: 2833, Accession: P49682, SwissProt: P49682 |
|---|
| Catalog # | NBP2-38547 |
|---|
| Price | |
|---|
| Order / More Info | CXCR3 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|