| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Polypeptide GalNac Transferase 1/GALNT1 |
|---|
| Clone | 3C10 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG2a kappa |
|---|
| Format | IgG purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, ELISA, Immunocytochemistry/Immunofluorescence. Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Polypeptide GalNac Transferase 1/GALNT1 Antibody (3C10) from Novus Biologicals is a mouse monoclonal antibody to Polypeptide GalNac Transferase 1/GALNT1. This antibody reacts with human. The Polypeptide GalNac Transferase 1/GALNT1 Antibody (3C10) has been validated for the following applications: Western Blot, ELISA, Immunocytochemistry/Immunofluorescence. |
|---|
| Immunogen | GALNT1 (NP_065207, 42 a.a. - 123 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. LPAGDVLEPVQKPHEGPGEMGKPVVIPKEDQEKMKEMFKINQFNLMASEMIALNRSLPDVRLEGCKTKVYPDNLPTTSVVIV |
|---|
| Other Names | EC 2.4.1.41, GalNAc transferase 1, GALNAC-T1, Polypeptide GalNAc transferase 1, polypeptide N-acetylgalactosaminyltransferase 1, pp-GaNTase 1, Protein-UDP acetylgalactosaminyltransferase 1, UDP-GalNAc:polypeptide N-acetylgalactosaminyltransferase 1, UDP-N-acetyl-alpha-D-galactosamine:polypeptideN-acetylgalactosaminyltransferase 1 (GalNAc-T1) |
|---|
| Gene, Accession # | GALNT1, Gene ID: 2589, Accession: NP_065207, SwissProt: NP_065207 |
|---|
| Catalog # | H00002589-M10 |
|---|
| Price | |
|---|
| Order / More Info | Polypeptide GalNac Transferase 1/GALNT1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|