| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Polypeptide GalNac Transferase 1/GALNT1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 25ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Polypeptide GalNac Transferase 1/GALNT1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Polypeptide GalNac Transferase 1/GALNT1. This antibody reacts with human. The Polypeptide GalNac Transferase 1/GALNT1 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: KERGLPAGDVLEPVQKPHEGPGEMGKPVVIPKEDQEKMKEMFKINQFNLMASEMIALNRSLPD |
|---|
| Other Names | EC 2.4.1.41, GalNAc transferase 1, GALNAC-T1, Polypeptide GalNAc transferase 1, polypeptide N-acetylgalactosaminyltransferase 1, pp-GaNTase 1, Protein-UDP acetylgalactosaminyltransferase 1, UDP-GalNAc:polypeptide N-acetylgalactosaminyltransferase 1, UDP-N-acetyl-alpha-D-galactosamine:polypeptideN-acetylgalactosaminyltransferase 1 (GalNAc-T1) |
|---|
| Gene, Accession # | GALNT1, Gene ID: 2589 |
|---|
| Catalog # | NBP1-81852-25ul |
|---|
| Price | |
|---|
| Order / More Info | Polypeptide GalNac Transferase 1/GALNT1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|