| Edit |   |
|---|
| Antigenic Specificity | Zfp275 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | mouse |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Zfp275 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Zfp275. This antibody reacts with mouse. The Zfp275 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | The specific Immunogen is proprietary information. Peptide sequence LAEHQRIHSGAKPYGCPHCGKLFRRSSELTKHRRIHTGEKPYECNQCGKA. |
|---|
| Other Names | DXBay20, zinc finger protein 275 |
|---|
| Gene, Accession # | Zfp275, Gene ID: 27081, Accession: NP_113682 |
|---|
| Catalog # | NBP1-91319 |
|---|
| Price | |
|---|
| Order / More Info | Zfp275 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|