| Edit |   |
| Antigenic Specificity | ZFP3 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified, no preservative |
| Size | 20ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The ZFP3 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ZFP3. This antibody reacts with human. The ZFP3 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptide directed towards the N terminal of human ZFP3. Peptide sequence TTEGVSAFATSGQNFLEILESNKTQRSSVGEKPHTCKECGKAFNQNSHLI. |
| Other Names | MRX89MGC8941, zinc finger protein 41 |
| Gene, Accession # | ZFP3, Gene ID: 124961, Accession: NP_694563, SwissProt: NP_694563 |
| Catalog # | NBP1-80171-20ul |
| Price | |
| Order / More Info | ZFP3 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |